Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3526262..3526956 | Replicon | chromosome |
Accession | NZ_CP111008 | ||
Organism | Escherichia coli strain J53-p130 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | ORI87_RS17385 | Protein ID | WP_001263489.1 |
Coordinates | 3526262..3526660 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | ORI87_RS17390 | Protein ID | WP_000554758.1 |
Coordinates | 3526663..3526956 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3521850) | 3521850..3521930 | - | 81 | NuclAT_12 | - | - |
- (3521850) | 3521850..3521930 | - | 81 | NuclAT_12 | - | - |
- (3521850) | 3521850..3521930 | - | 81 | NuclAT_12 | - | - |
- (3521850) | 3521850..3521930 | - | 81 | NuclAT_12 | - | - |
ORI87_RS17360 (3522526) | 3522526..3522984 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
ORI87_RS17365 (3523245) | 3523245..3524702 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
ORI87_RS17370 (3524759) | 3524759..3525280 | - | 522 | Protein_3399 | peptide chain release factor H | - |
ORI87_RS17375 (3525276) | 3525276..3525482 | - | 207 | Protein_3400 | RtcB family protein | - |
ORI87_RS17380 (3525800) | 3525800..3526252 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
ORI87_RS17385 (3526262) | 3526262..3526660 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
ORI87_RS17390 (3526663) | 3526663..3526956 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
ORI87_RS17395 (3527008) | 3527008..3528063 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
ORI87_RS17400 (3528134) | 3528134..3528919 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
ORI87_RS17405 (3528891) | 3528891..3530603 | + | 1713 | Protein_3406 | flagellar biosynthesis protein FlhA | - |
ORI87_RS17410 (3530827) | 3530827..3531324 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T264788 WP_001263489.1 NZ_CP111008:c3526660-3526262 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |