Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 309747..309941 | Replicon | chromosome |
Accession | NC_017316 | ||
Organism | Enterococcus faecalis OG1RF |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OG1RF_RS13860 | Protein ID | WP_015543884.1 |
Coordinates | 309846..309941 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 309747..309811 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OG1RF_RS01610 | 305365..307107 | + | 1743 | WP_014524947.1 | PTS transporter subunit EIIC | - |
OG1RF_RS01615 | 307098..309131 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
OG1RF_RS01620 | 309142..309576 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 309747..309811 | + | 65 | NuclAT_11 | - | Antitoxin |
OG1RF_RS13860 | 309846..309941 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OG1RF_RS01630 | 310187..311959 | + | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
OG1RF_RS01635 | 311974..312411 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OG1RF_RS01640 | 312426..313580 | + | 1155 | WP_002413493.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OG1RF_RS01645 | 313649..314764 | - | 1116 | WP_002413492.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T26477 WP_015543884.1 NC_017316:c309941-309846 [Enterococcus faecalis OG1RF]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T26477 NC_017316:c309941-309846 [Enterococcus faecalis OG1RF]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT26477 NC_017316:309747-309811 [Enterococcus faecalis OG1RF]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|