Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 3841109..3841521 | Replicon | chromosome |
Accession | NZ_CP111004 | ||
Organism | Escherichia coli strain J53-p131 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | ORI86_RS18870 | Protein ID | WP_000132601.1 |
Coordinates | 3841180..3841521 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 3841109..3841185 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI86_RS18860 (3837972) | 3837972..3839561 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
ORI86_RS18865 (3839558) | 3839558..3840952 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3841109) | 3841109..3841185 | - | 77 | NuclAT_15 | - | Antitoxin |
ORI86_RS18870 (3841180) | 3841180..3841521 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
ORI86_RS18875 (3841683) | 3841683..3843062 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
ORI86_RS18880 (3843062) | 3843062..3844108 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T264762 WP_000132601.1 NZ_CP111004:3841180-3841521 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT264762 NZ_CP111004:c3841185-3841109 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|