Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 49038..49280 | Replicon | plasmid EF62pB |
| Accession | NC_017313 | ||
| Organism | Enterococcus faecalis 62 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | EF62_RS15720 | Protein ID | WP_002360667.1 |
| Coordinates | 49038..49148 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 49189..49280 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF62_RS15680 (44957) | 44957..45577 | + | 621 | WP_002366000.1 | recombinase family protein | - |
| EF62_RS15685 (45567) | 45567..45881 | + | 315 | WP_025190469.1 | hypothetical protein | - |
| EF62_RS15690 (45875) | 45875..46099 | + | 225 | WP_002414746.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| EF62_RS15695 (46160) | 46160..46369 | + | 210 | WP_014524913.1 | hypothetical protein | - |
| EF62_RS15700 (46381) | 46381..46683 | + | 303 | WP_002393766.1 | DUF6440 family protein | - |
| EF62_RS15705 (47112) | 47112..48440 | + | 1329 | WP_002415105.1 | ultraviolet resistance protein UvrA | - |
| EF62_RS15710 (48437) | 48437..48787 | + | 351 | WP_002406178.1 | hypothetical protein | - |
| EF62_RS16385 (48744) | 48744..48956 | + | 213 | WP_002406179.1 | hypothetical protein | - |
| EF62_RS15720 (49038) | 49038..49148 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (49189) | 49189..49280 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (49189) | 49189..49280 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (49189) | 49189..49280 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (49189) | 49189..49280 | - | 92 | NuclAT_0 | - | Antitoxin |
| EF62_RS15725 (49389) | 49389..49685 | + | 297 | WP_002406180.1 | replication control protein PrgN | - |
| EF62_RS15730 (49787) | 49787..50062 | - | 276 | WP_002369783.1 | DNA segregation protein PrgO | - |
| EF62_RS15735 (50040) | 50040..50969 | - | 930 | WP_002366009.1 | ParA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..51104 | 51104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T26476 WP_002360667.1 NC_017313:49038-49148 [Enterococcus faecalis 62]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T26476 NC_017313:49038-49148 [Enterococcus faecalis 62]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 92 bp
>AT26476 NC_017313:c49280-49189 [Enterococcus faecalis 62]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|