Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3526669..3527363 | Replicon | chromosome |
Accession | NZ_CP110999 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | ORI88_RS17390 | Protein ID | WP_001263489.1 |
Coordinates | 3526669..3527067 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | ORI88_RS17395 | Protein ID | WP_000554758.1 |
Coordinates | 3527070..3527363 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3522257) | 3522257..3522337 | - | 81 | NuclAT_12 | - | - |
- (3522257) | 3522257..3522337 | - | 81 | NuclAT_12 | - | - |
- (3522257) | 3522257..3522337 | - | 81 | NuclAT_12 | - | - |
- (3522257) | 3522257..3522337 | - | 81 | NuclAT_12 | - | - |
ORI88_RS17365 (3522933) | 3522933..3523391 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
ORI88_RS17370 (3523652) | 3523652..3525109 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
ORI88_RS17375 (3525166) | 3525166..3525687 | - | 522 | Protein_3399 | peptide chain release factor H | - |
ORI88_RS17380 (3525683) | 3525683..3525889 | - | 207 | Protein_3400 | RtcB family protein | - |
ORI88_RS17385 (3526207) | 3526207..3526659 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
ORI88_RS17390 (3526669) | 3526669..3527067 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
ORI88_RS17395 (3527070) | 3527070..3527363 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
ORI88_RS17400 (3527415) | 3527415..3528470 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
ORI88_RS17405 (3528541) | 3528541..3529326 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
ORI88_RS17410 (3529298) | 3529298..3531010 | + | 1713 | Protein_3406 | flagellar biosynthesis protein FlhA | - |
ORI88_RS17415 (3531234) | 3531234..3531731 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T264731 WP_001263489.1 NZ_CP110999:c3527067-3526669 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |