Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 127335..127604 | Replicon | plasmid pYUXYEH3783-NDM |
| Accession | NZ_CP110998 | ||
| Organism | Escherichia coli strain XYEH3783 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | ORI30_RS25245 | Protein ID | WP_001372321.1 |
| Coordinates | 127479..127604 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 127335..127400 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI30_RS25210 | 123045..123572 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| ORI30_RS25215 | 123630..123863 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| ORI30_RS25220 | 123924..125947 | + | 2024 | Protein_144 | ParB/RepB/Spo0J family partition protein | - |
| ORI30_RS25225 | 126016..126450 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| ORI30_RS25230 | 126447..127209 | + | 763 | Protein_146 | plasmid SOS inhibition protein A | - |
| - | 127178..127402 | + | 225 | NuclAT_0 | - | - |
| - | 127178..127402 | + | 225 | NuclAT_0 | - | - |
| - | 127178..127402 | + | 225 | NuclAT_0 | - | - |
| - | 127178..127402 | + | 225 | NuclAT_0 | - | - |
| ORI30_RS25235 | 127187..127366 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 127335..127400 | - | 66 | - | - | Antitoxin |
| ORI30_RS25240 | 127388..127537 | + | 150 | Protein_148 | plasmid maintenance protein Mok | - |
| ORI30_RS25245 | 127479..127604 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ORI30_RS25250 | 127923..128219 | - | 297 | Protein_150 | hypothetical protein | - |
| ORI30_RS25255 | 128519..128815 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| ORI30_RS25260 | 128926..129747 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| ORI30_RS25265 | 130044..130634 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| ORI30_RS25270 | 130969..131352 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| ORI30_RS25275 | 131546..132217 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| ORI30_RS25280 | 132354..132581 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD | iucA / iucB / iucC / iucC / iucD / iutA | 1..168068 | 168068 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T264713 WP_001372321.1 NZ_CP110998:127479-127604 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT264713 NZ_CP110998:c127400-127335 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|