Detailed information of TA system TA264713

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 127335..127604
• Replicon: plasmid pYUXYEH3783-NDM
• Accession: NZ_CP110998
• Organism: Escherichia coli strain XYEH3783

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: ORI30_RS25245
• Protein ID: WP_001372321.1
• Coordinates: 127479..127604 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	127335..127400 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ORI30_RS25210	123045..123572	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
ORI30_RS25215	123630..123863	+	234	WP_000006003.1	DUF905 family protein	-
ORI30_RS25220	123924..125947	+	2024	Protein_144	ParB/RepB/Spo0J family partition protein	-
ORI30_RS25225	126016..126450	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
ORI30_RS25230	126447..127209	+	763	Protein_146	plasmid SOS inhibition protein A	-
-	127178..127402	+	225	NuclAT_0	-	-
-	127178..127402	+	225	NuclAT_0	-	-
-	127178..127402	+	225	NuclAT_0	-	-
-	127178..127402	+	225	NuclAT_0	-	-
ORI30_RS25235	127187..127366	-	180	WP_001309233.1	hypothetical protein	-
-	127335..127400	-	66	-	-	Antitoxin
ORI30_RS25240	127388..127537	+	150	Protein_148	plasmid maintenance protein Mok	-
ORI30_RS25245	127479..127604	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
ORI30_RS25250	127923..128219	-	297	Protein_150	hypothetical protein	-
ORI30_RS25255	128519..128815	+	297	WP_001272251.1	hypothetical protein	-
ORI30_RS25260	128926..129747	+	822	WP_001234445.1	DUF932 domain-containing protein	-
ORI30_RS25265	130044..130634	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
ORI30_RS25270	130969..131352	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
ORI30_RS25275	131546..132217	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
ORI30_RS25280	132354..132581	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD	iucA / iucB / iucC / iucC / iucD / iutA	1..168068	168068

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T264713 WP_001372321.1 NZ_CP110998:127479-127604 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT264713 NZ_CP110998:c127400-127335 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin