Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3897280..3897974 | Replicon | chromosome |
| Accession | NZ_CP110996 | ||
| Organism | Escherichia coli strain XYEH3783 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | ORI30_RS18790 | Protein ID | WP_001263500.1 |
| Coordinates | 3897576..3897974 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | ORI30_RS18785 | Protein ID | WP_000554758.1 |
| Coordinates | 3897280..3897573 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI30_RS18760 (3893107) | 3893107..3893574 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
| ORI30_RS18765 (3893594) | 3893594..3894310 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| ORI30_RS18770 (3894323) | 3894323..3895186 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| ORI30_RS18775 (3895189) | 3895189..3896112 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| ORI30_RS18780 (3896183) | 3896183..3897228 | + | 1046 | Protein_3665 | DNA polymerase IV | - |
| ORI30_RS18785 (3897280) | 3897280..3897573 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| ORI30_RS18790 (3897576) | 3897576..3897974 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| ORI30_RS18795 (3897984) | 3897984..3898436 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| ORI30_RS18800 (3898626) | 3898626..3899765 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| ORI30_RS18805 (3899762) | 3899762..3900376 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
| ORI30_RS18810 (3900433) | 3900433..3901890 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| ORI30_RS18815 (3902151) | 3902151..3902609 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T264706 WP_001263500.1 NZ_CP110996:3897576-3897974 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|