Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2868447..2869049 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | ORI30_RS13785 | Protein ID | WP_000897302.1 |
Coordinates | 2868447..2868758 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ORI30_RS13790 | Protein ID | WP_000356397.1 |
Coordinates | 2868759..2869049 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS13755 (2863477) | 2863477..2864262 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
ORI30_RS13760 (2864361) | 2864361..2864960 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
ORI30_RS13765 (2864954) | 2864954..2865826 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
ORI30_RS13770 (2865823) | 2865823..2866260 | + | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
ORI30_RS13775 (2866305) | 2866305..2867246 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
ORI30_RS13780 (2867310) | 2867310..2868218 | - | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
ORI30_RS13785 (2868447) | 2868447..2868758 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
ORI30_RS13790 (2868759) | 2868759..2869049 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
ORI30_RS13795 (2869408) | 2869408..2869686 | + | 279 | WP_001296612.1 | hypothetical protein | - |
ORI30_RS13800 (2870082) | 2870082..2870300 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
ORI30_RS13805 (2870516) | 2870516..2871445 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
ORI30_RS13810 (2871442) | 2871442..2872077 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
ORI30_RS13815 (2872074) | 2872074..2872976 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T264696 WP_000897302.1 NZ_CP110996:2868447-2868758 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|