Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1983228..1983955 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | ORI30_RS09510 | Protein ID | WP_000550189.1 |
Coordinates | 1983641..1983955 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ORI30_RS09505 | Protein ID | WP_000560266.1 |
Coordinates | 1983228..1983644 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS09495 (1978388) | 1978388..1980739 | + | 2352 | WP_000695487.1 | alpha-glucosidase | - |
ORI30_RS09500 (1981165) | 1981165..1983183 | + | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
ORI30_RS09505 (1983228) | 1983228..1983644 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
ORI30_RS09510 (1983641) | 1983641..1983955 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
ORI30_RS09515 (1984239) | 1984239..1985375 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
ORI30_RS09520 (1985460) | 1985460..1985963 | + | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
ORI30_RS09525 (1986040) | 1986040..1986732 | + | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
ORI30_RS09530 (1986811) | 1986811..1987797 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T264694 WP_000550189.1 NZ_CP110996:c1983955-1983641 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT264694 WP_000560266.1 NZ_CP110996:c1983644-1983228 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|