Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1918248..1918941 | Replicon | chromosome |
| Accession | NZ_CP110996 | ||
| Organism | Escherichia coli strain XYEH3783 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | ORI30_RS09195 | Protein ID | WP_000415584.1 |
| Coordinates | 1918645..1918941 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | ORI30_RS09190 | Protein ID | WP_000650107.1 |
| Coordinates | 1918248..1918643 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI30_RS09180 (1914112) | 1914112..1916370 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
| ORI30_RS09185 (1916508) | 1916508..1918115 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| ORI30_RS09190 (1918248) | 1918248..1918643 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| ORI30_RS09195 (1918645) | 1918645..1918941 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| ORI30_RS09200 (1919146) | 1919146..1919628 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| ORI30_RS09205 (1919681) | 1919681..1920073 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| ORI30_RS09210 (1920225) | 1920225..1920884 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| ORI30_RS09215 (1920881) | 1920881..1922230 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| ORI30_RS09220 (1922276) | 1922276..1922608 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
| ORI30_RS09225 (1922927) | 1922927..1923508 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| ORI30_RS09230 (1923539) | 1923539..1923853 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1909785..1918941 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T264693 WP_000415584.1 NZ_CP110996:c1918941-1918645 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT264693 WP_000650107.1 NZ_CP110996:c1918643-1918248 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|