Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54533..54802 | Replicon | plasmid pYUXYEH3314-NDM |
| Accession | NZ_CP110995 | ||
| Organism | Escherichia coli strain XYEH3314 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | G9G195 |
| Locus tag | ORI32_RS25305 | Protein ID | WP_001323520.1 |
| Coordinates | 54686..54802 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 54533..54598 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI32_RS25270 | 50342..50839 | + | 498 | WP_095719660.1 | single-stranded DNA-binding protein | - |
| ORI32_RS25275 | 50902..51135 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| ORI32_RS25280 | 51201..53159 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
| ORI32_RS25285 | 53214..53648 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| ORI32_RS25290 | 53645..54407 | + | 763 | Protein_68 | plasmid SOS inhibition protein A | - |
| ORI32_RS25295 | 54376..54564 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 54376..54600 | + | 225 | NuclAT_0 | - | - |
| - | 54376..54600 | + | 225 | NuclAT_0 | - | - |
| - | 54376..54600 | + | 225 | NuclAT_0 | - | - |
| - | 54376..54600 | + | 225 | NuclAT_0 | - | - |
| - | 54533..54598 | - | 66 | - | - | Antitoxin |
| ORI32_RS25300 | 54586..54735 | + | 150 | Protein_70 | plasmid maintenance protein Mok | - |
| ORI32_RS25305 | 54686..54802 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ORI32_RS25310 | 55022..55252 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| ORI32_RS25315 | 55250..55423 | - | 174 | Protein_73 | hypothetical protein | - |
| ORI32_RS25320 | 55493..55699 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| ORI32_RS25325 | 55724..56011 | + | 288 | WP_000107544.1 | hypothetical protein | - |
| ORI32_RS25330 | 56129..56950 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| ORI32_RS25335 | 57247..57894 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
| ORI32_RS25340 | 58171..58554 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| ORI32_RS25345 | 58745..59431 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| ORI32_RS25350 | 59525..59752 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T264684 WP_001323520.1 NZ_CP110995:54686-54802 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 66 bp
>AT264684 NZ_CP110995:c54598-54533 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|