Detailed information of TA system TA264684

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 54533..54802
• Replicon: plasmid pYUXYEH3314-NDM
• Accession: NZ_CP110995
• Organism: Escherichia coli strain XYEH3314

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: ORI32_RS25305
• Protein ID: WP_001323520.1
• Coordinates: 54686..54802 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	54533..54598 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ORI32_RS25270	50342..50839	+	498	WP_095719660.1	single-stranded DNA-binding protein	-
ORI32_RS25275	50902..51135	+	234	WP_000005990.1	DUF905 family protein	-
ORI32_RS25280	51201..53159	+	1959	WP_001825193.1	ParB/RepB/Spo0J family partition protein	-
ORI32_RS25285	53214..53648	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
ORI32_RS25290	53645..54407	+	763	Protein_68	plasmid SOS inhibition protein A	-
ORI32_RS25295	54376..54564	-	189	WP_001299721.1	hypothetical protein	-
-	54376..54600	+	225	NuclAT_0	-	-
-	54376..54600	+	225	NuclAT_0	-	-
-	54376..54600	+	225	NuclAT_0	-	-
-	54376..54600	+	225	NuclAT_0	-	-
-	54533..54598	-	66	-	-	Antitoxin
ORI32_RS25300	54586..54735	+	150	Protein_70	plasmid maintenance protein Mok	-
ORI32_RS25305	54686..54802	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
ORI32_RS25310	55022..55252	+	231	WP_001426396.1	hypothetical protein	-
ORI32_RS25315	55250..55423	-	174	Protein_73	hypothetical protein	-
ORI32_RS25320	55493..55699	+	207	WP_000547968.1	hypothetical protein	-
ORI32_RS25325	55724..56011	+	288	WP_000107544.1	hypothetical protein	-
ORI32_RS25330	56129..56950	+	822	WP_001234469.1	DUF932 domain-containing protein	-
ORI32_RS25335	57247..57894	-	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
ORI32_RS25340	58171..58554	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
ORI32_RS25345	58745..59431	+	687	WP_000332484.1	PAS domain-containing protein	-
ORI32_RS25350	59525..59752	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T264684 WP_001323520.1 NZ_CP110995:54686-54802 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT264684 NZ_CP110995:c54598-54533 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin