Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 54376..54802 | Replicon | plasmid pYUXYEH3314-NDM |
Accession | NZ_CP110995 | ||
Organism | Escherichia coli strain XYEH3314 |
Toxin (Protein)
Gene name | hok | Uniprot ID | G9G195 |
Locus tag | ORI32_RS25305 | Protein ID | WP_001323520.1 |
Coordinates | 54686..54802 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 54376..54600 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI32_RS25270 (50342) | 50342..50839 | + | 498 | WP_095719660.1 | single-stranded DNA-binding protein | - |
ORI32_RS25275 (50902) | 50902..51135 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
ORI32_RS25280 (51201) | 51201..53159 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
ORI32_RS25285 (53214) | 53214..53648 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
ORI32_RS25290 (53645) | 53645..54407 | + | 763 | Protein_68 | plasmid SOS inhibition protein A | - |
ORI32_RS25295 (54376) | 54376..54564 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- (54376) | 54376..54600 | + | 225 | NuclAT_0 | - | Antitoxin |
- (54376) | 54376..54600 | + | 225 | NuclAT_0 | - | Antitoxin |
- (54376) | 54376..54600 | + | 225 | NuclAT_0 | - | Antitoxin |
- (54376) | 54376..54600 | + | 225 | NuclAT_0 | - | Antitoxin |
ORI32_RS25300 (54586) | 54586..54735 | + | 150 | Protein_70 | plasmid maintenance protein Mok | - |
ORI32_RS25305 (54686) | 54686..54802 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
ORI32_RS25310 (55022) | 55022..55252 | + | 231 | WP_001426396.1 | hypothetical protein | - |
ORI32_RS25315 (55250) | 55250..55423 | - | 174 | Protein_73 | hypothetical protein | - |
ORI32_RS25320 (55493) | 55493..55699 | + | 207 | WP_000547968.1 | hypothetical protein | - |
ORI32_RS25325 (55724) | 55724..56011 | + | 288 | WP_000107544.1 | hypothetical protein | - |
ORI32_RS25330 (56129) | 56129..56950 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
ORI32_RS25335 (57247) | 57247..57894 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
ORI32_RS25340 (58171) | 58171..58554 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
ORI32_RS25345 (58745) | 58745..59431 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
ORI32_RS25350 (59525) | 59525..59752 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T264683 WP_001323520.1 NZ_CP110995:54686-54802 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 225 bp
>AT264683 NZ_CP110995:54376-54600 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|