Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3776403..3777097 | Replicon | chromosome |
| Accession | NZ_CP110988 | ||
| Organism | Escherichia coli strain XYEH3314 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | ORI32_RS18395 | Protein ID | WP_001263493.1 |
| Coordinates | 3776403..3776801 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | ORI32_RS18400 | Protein ID | WP_000554757.1 |
| Coordinates | 3776804..3777097 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3772063) | 3772063..3772143 | - | 81 | NuclAT_11 | - | - |
| - (3772063) | 3772063..3772143 | - | 81 | NuclAT_11 | - | - |
| - (3772063) | 3772063..3772143 | - | 81 | NuclAT_11 | - | - |
| - (3772063) | 3772063..3772143 | - | 81 | NuclAT_11 | - | - |
| ORI32_RS18365 (3771403) | 3771403..3772647 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| ORI32_RS18370 (3772739) | 3772739..3773197 | - | 459 | WP_061349133.1 | xanthine phosphoribosyltransferase | - |
| ORI32_RS18375 (3773458) | 3773458..3774915 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| ORI32_RS18380 (3774972) | 3774972..3775493 | - | 522 | Protein_3599 | peptide chain release factor H | - |
| ORI32_RS18385 (3775492) | 3775492..3775695 | - | 204 | Protein_3600 | RtcB family protein | - |
| ORI32_RS18390 (3775941) | 3775941..3776393 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| ORI32_RS18395 (3776403) | 3776403..3776801 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| ORI32_RS18400 (3776804) | 3776804..3777097 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| ORI32_RS18405 (3777149) | 3777149..3778204 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| ORI32_RS18410 (3778275) | 3778275..3779060 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| ORI32_RS18415 (3779032) | 3779032..3780744 | + | 1713 | Protein_3606 | flagellar biosynthesis protein FlhA | - |
| ORI32_RS18420 (3780968) | 3780968..3781465 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T264678 WP_001263493.1 NZ_CP110988:c3776801-3776403 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|