Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 686801..687528 | Replicon | chromosome |
Accession | NZ_CP110988 | ||
Organism | Escherichia coli strain XYEH3314 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | ORI32_RS03320 | Protein ID | WP_000550189.1 |
Coordinates | 686801..687115 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ORI32_RS03325 | Protein ID | WP_000560266.1 |
Coordinates | 687112..687528 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI32_RS03300 (682959) | 682959..683945 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
ORI32_RS03305 (684024) | 684024..684716 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
ORI32_RS03310 (684793) | 684793..685296 | - | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
ORI32_RS03315 (685381) | 685381..686517 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
ORI32_RS03320 (686801) | 686801..687115 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
ORI32_RS03325 (687112) | 687112..687528 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
ORI32_RS03330 (687573) | 687573..689591 | - | 2019 | WP_064221460.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
ORI32_RS03335 (689917) | 689917..692268 | - | 2352 | WP_000695486.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T264664 WP_000550189.1 NZ_CP110988:686801-687115 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT264664 WP_000560266.1 NZ_CP110988:687112-687528 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|