Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 637497..638296 | Replicon | chromosome |
Accession | NZ_CP110988 | ||
Organism | Escherichia coli strain XYEH3314 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | ORI32_RS03070 | Protein ID | WP_000347251.1 |
Coordinates | 637497..637961 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | ORI32_RS03075 | Protein ID | WP_001308975.1 |
Coordinates | 637961..638296 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI32_RS03040 (632498) | 632498..632932 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
ORI32_RS03045 (632950) | 632950..633828 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
ORI32_RS03050 (633818) | 633818..634597 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
ORI32_RS03055 (634608) | 634608..635081 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
ORI32_RS03060 (635104) | 635104..636384 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
ORI32_RS03065 (636633) | 636633..637442 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
ORI32_RS03070 (637497) | 637497..637961 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
ORI32_RS03075 (637961) | 637961..638296 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
ORI32_RS03080 (638445) | 638445..640016 | - | 1572 | WP_064221457.1 | galactarate dehydratase | - |
ORI32_RS03085 (640391) | 640391..641725 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
ORI32_RS03090 (641741) | 641741..642511 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T264663 WP_000347251.1 NZ_CP110988:c637961-637497 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D6JF08 |