Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3649523..3650217 Replicon chromosome
Accession NZ_CP110978
Organism Escherichia coli strain XYEH3934

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag ORI33_RS17560 Protein ID WP_001263493.1
Coordinates 3649523..3649921 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag ORI33_RS17565 Protein ID WP_000554757.1
Coordinates 3649924..3650217 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3645183) 3645183..3645263 - 81 NuclAT_12 - -
- (3645183) 3645183..3645263 - 81 NuclAT_12 - -
- (3645183) 3645183..3645263 - 81 NuclAT_12 - -
- (3645183) 3645183..3645263 - 81 NuclAT_12 - -
ORI33_RS17530 (3644523) 3644523..3645767 - 1245 WP_000189541.1 esterase FrsA -
ORI33_RS17535 (3645859) 3645859..3646317 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
ORI33_RS17540 (3646578) 3646578..3648035 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
ORI33_RS17545 (3648092) 3648092..3648613 - 522 Protein_3431 peptide chain release factor H -
ORI33_RS17550 (3648612) 3648612..3648815 - 204 Protein_3432 RtcB family protein -
ORI33_RS17555 (3649061) 3649061..3649513 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
ORI33_RS17560 (3649523) 3649523..3649921 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
ORI33_RS17565 (3649924) 3649924..3650217 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
ORI33_RS17570 (3650269) 3650269..3651324 - 1056 WP_266057939.1 DNA polymerase IV -
ORI33_RS17575 (3651395) 3651395..3652319 - 925 Protein_3437 putative lateral flagellar export/assembly protein LafU -
ORI33_RS17580 (3652322) 3652322..3653185 - 864 WP_001169518.1 flagellar motor stator protein MotA -
ORI33_RS17585 (3653198) 3653198..3653917 - 720 WP_000938740.1 FliA/WhiG family RNA polymerase sigma factor -
ORI33_RS17590 (3653937) 3653937..3654404 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3626754..3650217 23463


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T264655 WP_001263493.1 NZ_CP110978:c3649921-3649523 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT264655 WP_000554757.1 NZ_CP110978:c3650217-3649924 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References