Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2421029..2421667 | Replicon | chromosome |
| Accession | NZ_CP110978 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | ORI33_RS11660 | Protein ID | WP_000813794.1 |
| Coordinates | 2421491..2421667 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | ORI33_RS11655 | Protein ID | WP_001270286.1 |
| Coordinates | 2421029..2421445 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS11635 (2416181) | 2416181..2417122 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| ORI33_RS11640 (2417123) | 2417123..2418136 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| ORI33_RS11645 (2418154) | 2418154..2419299 | - | 1146 | WP_266057217.1 | ABC transporter substrate-binding protein | - |
| ORI33_RS11650 (2419544) | 2419544..2420950 | - | 1407 | WP_095885713.1 | PLP-dependent aminotransferase family protein | - |
| ORI33_RS11655 (2421029) | 2421029..2421445 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| ORI33_RS11660 (2421491) | 2421491..2421667 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| ORI33_RS11665 (2421889) | 2421889..2422119 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| ORI33_RS11670 (2422211) | 2422211..2424172 | - | 1962 | WP_001515270.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| ORI33_RS11675 (2424245) | 2424245..2424781 | - | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
| ORI33_RS11680 (2424873) | 2424873..2426048 | + | 1176 | WP_231708907.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2426088..2427236 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T264651 WP_000813794.1 NZ_CP110978:c2421667-2421491 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT264651 WP_001270286.1 NZ_CP110978:c2421445-2421029 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|