Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 660820..661547 | Replicon | chromosome |
Accession | NZ_CP110978 | ||
Organism | Escherichia coli strain XYEH3934 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | ORI33_RS03210 | Protein ID | WP_000550189.1 |
Coordinates | 660820..661134 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ORI33_RS03215 | Protein ID | WP_000560266.1 |
Coordinates | 661131..661547 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI33_RS03190 (656987) | 656987..657973 | - | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
ORI33_RS03195 (658052) | 658052..658735 | - | 684 | WP_001183040.1 | vancomycin high temperature exclusion protein | - |
ORI33_RS03200 (658812) | 658812..659315 | - | 504 | WP_024226837.1 | M48 family metallopeptidase | - |
ORI33_RS03205 (659400) | 659400..660536 | + | 1137 | WP_201476727.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
ORI33_RS03210 (660820) | 660820..661134 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
ORI33_RS03215 (661131) | 661131..661547 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
ORI33_RS03220 (661592) | 661592..663610 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
ORI33_RS03225 (663836) | 663836..666187 | - | 2352 | WP_000695486.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T264641 WP_000550189.1 NZ_CP110978:660820-661134 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT264641 WP_000560266.1 NZ_CP110978:661131-661547 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|