Detailed information of TA system TA264636

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 13609..14266
• Replicon: plasmid pIT-424-AC2
• Accession: NZ_CP110969
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain LC-424/19

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: NPX97_RS27855
• Protein ID: WP_000270043.1
• Coordinates: 13916..14266 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: NPX97_RS27850
• Protein ID: WP_000124640.1
• Coordinates: 13609..13911 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NPX97_RS27805 (NPX97_27805)	9234..9662	+	429	WP_000591074.1	hypothetical protein	-
NPX97_RS27810 (NPX97_27810)	9719..10078	+	360	WP_000422768.1	hypothetical protein	-
NPX97_RS27815 (NPX97_27815)	10078..10524	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
NPX97_RS27820 (NPX97_27820)	10521..11039	+	519	WP_000210756.1	nitrite reductase	-
NPX97_RS27825 (NPX97_27825)	11039..11269	+	231	WP_000972663.1	hypothetical protein	-
NPX97_RS27830 (NPX97_27830)	11256..12113	+	858	WP_001167032.1	hypothetical protein	-
NPX97_RS27835 (NPX97_27835)	12344..12871	+	528	WP_001236377.1	thermonuclease family protein	-
NPX97_RS27840 (NPX97_27840)	12929..13201	+	273	WP_001043047.1	HU family DNA-binding protein	-
NPX97_RS27845 (NPX97_27845)	13289..13582	+	294	WP_001239997.1	chromosome segregation protein ParM	-
NPX97_RS27850 (NPX97_27850)	13609..13911	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
NPX97_RS27855 (NPX97_27855)	13916..14266	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NPX97_RS27860 (NPX97_27860)	14429..14977	+	549	WP_001061574.1	transcriptional regulator	-
NPX97_RS27865 (NPX97_27865)	15318..15512	+	195	WP_000343597.1	hypothetical protein	-
NPX97_RS27870 (NPX97_27870)	15523..15894	+	372	WP_000516916.1	hypothetical protein	-
NPX97_RS27875 (NPX97_27875)	15887..16357	+	471	WP_001281821.1	hypothetical protein	-
NPX97_RS27880 (NPX97_27880)	16372..16707	-	336	WP_000683476.1	hypothetical protein	-
NPX97_RS27885 (NPX97_27885)	16804..17292	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
NPX97_RS27890 (NPX97_27890)	17295..17792	+	498	WP_000062185.1	hypothetical protein	-
NPX97_RS27895 (NPX97_27895)	18007..18711	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NPX97_RS27900 (NPX97_27900)	19018..19197	+	180	Protein_31	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / aph(6)-Id / aph(3'')-Ib / aph(3')-VIb / sul2 / blaCMY-16 / aph(3')-Ia	-	1..138197	138197

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T264636 WP_000270043.1 NZ_CP110969:c14266-13916 [Klebsiella pneumoniae subsp. pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT264636 WP_000124640.1 NZ_CP110969:c13911-13609 [Klebsiella pneumoniae subsp. pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9