Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4964663..4965249 Replicon chromosome
Accession NZ_CP110941
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-1873/18

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NPY10_RS24670 Protein ID WP_002920800.1
Coordinates 4964663..4965031 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NPY10_RS24675 Protein ID WP_002920802.1
Coordinates 4965028..4965249 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY10_RS24650 (NPY10_24650) 4960166..4961236 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NPY10_RS24655 (NPY10_24655) 4961238..4962083 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NPY10_RS24660 (NPY10_24660) 4962080..4962967 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NPY10_RS24665 (NPY10_24665) 4963074..4964390 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NPY10_RS24670 (NPY10_24670) 4964663..4965031 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NPY10_RS24675 (NPY10_24675) 4965028..4965249 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NPY10_RS24680 (NPY10_24680) 4965413..4966126 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NPY10_RS24685 (NPY10_24685) 4966128..4966895 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NPY10_RS24690 (NPY10_24690) 4966892..4968169 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NPY10_RS24695 (NPY10_24695) 4968166..4969092 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4959429..4968169 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T264554 WP_002920800.1 NZ_CP110941:c4965031-4964663 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT264554 WP_002920802.1 NZ_CP110941:c4965249-4965028 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References