264538

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4963905..4964491 Replicon chromosome
Accession NZ_CP110936
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NPY06_RS24685 Protein ID WP_002920800.1
Coordinates 4963905..4964273 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NPY06_RS24690 Protein ID WP_002920802.1
Coordinates 4964270..4964491 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY06_RS24665 (NPY06_24665) 4959408..4960478 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NPY06_RS24670 (NPY06_24670) 4960480..4961325 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NPY06_RS24675 (NPY06_24675) 4961322..4962209 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NPY06_RS24680 (NPY06_24680) 4962316..4963632 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NPY06_RS24685 (NPY06_24685) 4963905..4964273 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NPY06_RS24690 (NPY06_24690) 4964270..4964491 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NPY06_RS24695 (NPY06_24695) 4964655..4965368 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NPY06_RS24700 (NPY06_24700) 4965370..4966137 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NPY06_RS24705 (NPY06_24705) 4966134..4967411 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NPY06_RS24710 (NPY06_24710) 4967408..4968334 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4958671..4979259 20588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T264538 WP_002920800.1 NZ_CP110936:c4964273-4963905 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT264538 WP_002920802.1 NZ_CP110936:c4964491-4964270 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References