Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4550326..4551101 | Replicon | chromosome |
Accession | NZ_CP110936 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NPY06_RS22505 | Protein ID | WP_004150910.1 |
Coordinates | 4550326..4550811 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NPY06_RS22510 | Protein ID | WP_004150912.1 |
Coordinates | 4550808..4551101 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPY06_RS22480 (NPY06_22480) | 4545496..4546863 | - | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
NPY06_RS22485 (NPY06_22485) | 4546856..4547239 | - | 384 | WP_004150906.1 | hypothetical protein | - |
NPY06_RS22490 (NPY06_22490) | 4547239..4548111 | - | 873 | WP_004188557.1 | ParA family protein | - |
NPY06_RS22495 (NPY06_22495) | 4548717..4548933 | - | 217 | Protein_4396 | transposase | - |
NPY06_RS22500 (NPY06_22500) | 4549030..4549622 | - | 593 | Protein_4397 | hypothetical protein | - |
NPY06_RS22505 (NPY06_22505) | 4550326..4550811 | - | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NPY06_RS22510 (NPY06_22510) | 4550808..4551101 | - | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NPY06_RS22515 (NPY06_22515) | 4551746..4553122 | + | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NPY06_RS22520 (NPY06_22520) | 4553133..4554281 | + | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NPY06_RS22525 (NPY06_22525) | 4554282..4555193 | - | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NPY06_RS22530 (NPY06_22530) | 4555291..4555893 | + | 603 | WP_002916735.1 | short chain dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 4493309..4551352 | 58043 | ||
flank | IS/Tn | - | - | 4548781..4548933 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T264536 WP_004150910.1 NZ_CP110936:c4550811-4550326 [Klebsiella pneumoniae subsp. pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |