Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4558391..4558993 | Replicon | chromosome |
| Accession | NZ_CP110934 | ||
| Organism | Salmonella enterica strain CVCC 519 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | ORG43_RS22330 | Protein ID | WP_001159630.1 |
| Coordinates | 4558682..4558993 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ORG43_RS22325 | Protein ID | WP_000362050.1 |
| Coordinates | 4558391..4558681 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG43_RS22310 (4555884) | 4555884..4556786 | + | 903 | WP_001541228.1 | formate dehydrogenase subunit beta | - |
| ORG43_RS22315 (4556783) | 4556783..4557418 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| ORG43_RS22320 (4557415) | 4557415..4558344 | + | 930 | WP_001541226.1 | formate dehydrogenase accessory protein FdhE | - |
| ORG43_RS22325 (4558391) | 4558391..4558681 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| ORG43_RS22330 (4558682) | 4558682..4558993 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| ORG43_RS22335 (4559211) | 4559211..4560126 | + | 916 | Protein_4362 | alpha/beta hydrolase | - |
| ORG43_RS22340 (4560140) | 4560140..4561081 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| ORG43_RS22345 (4561126) | 4561126..4561563 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| ORG43_RS22350 (4561560) | 4561560..4562432 | - | 873 | WP_023235429.1 | virulence factor BrkB family protein | - |
| ORG43_RS22355 (4562426) | 4562426..4563025 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T264523 WP_001159630.1 NZ_CP110934:c4558993-4558682 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|