Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 2629710..2630238 Replicon chromosome
Accession NZ_CP110934
Organism Salmonella enterica strain CVCC 519

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag ORG43_RS12990 Protein ID WP_108429764.1
Coordinates 2629710..2629940 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag ORG43_RS12995 Protein ID WP_000147078.1
Coordinates 2629930..2630238 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORG43_RS12955 (2625537) 2625537..2625926 - 390 WP_001539749.1 RusA family crossover junction endodeoxyribonuclease -
ORG43_RS12960 (2625923) 2625923..2626576 - 654 WP_001539748.1 phage N-6-adenine-methyltransferase -
ORG43_RS12965 (2626576) 2626576..2627058 - 483 WP_023234881.1 PerC family transcriptional regulator -
ORG43_RS12970 (2627060) 2627060..2627878 - 819 WP_001539747.1 helix-turn-helix domain-containing protein -
ORG43_RS12975 (2627875) 2627875..2628099 - 225 WP_000620702.1 hypothetical protein -
ORG43_RS12980 (2628096) 2628096..2628833 - 738 Protein_2542 Rha family transcriptional regulator -
ORG43_RS12985 (2628957) 2628957..2629586 - 630 Protein_2543 Rha family transcriptional regulator -
ORG43_RS12990 (2629710) 2629710..2629940 + 231 WP_108429764.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORG43_RS12995 (2629930) 2629930..2630238 + 309 WP_000147078.1 helix-turn-helix transcriptional regulator Antitoxin
ORG43_RS13000 (2630257) 2630257..2630433 - 177 WP_001525520.1 DUF4222 domain-containing protein -
ORG43_RS13005 (2630573) 2630573..2631127 - 555 WP_000509731.1 YmfL family putative regulatory protein -
ORG43_RS13010 (2631156) 2631156..2631380 - 225 WP_001191666.1 helix-turn-helix transcriptional regulator -
ORG43_RS13015 (2631478) 2631478..2632173 + 696 WP_001020640.1 helix-turn-helix transcriptional regulator -
ORG43_RS13020 (2632508) 2632508..2632705 - 198 WP_001624554.1 hypothetical protein -
ORG43_RS13025 (2633263) 2633263..2633619 + 357 WP_001539742.1 hypothetical protein -
ORG43_RS13030 (2633677) 2633677..2634504 + 828 WP_023234876.1 DUF2303 family protein -
ORG43_RS13035 (2634641) 2634641..2634799 + 159 WP_000008355.1 hypothetical protein -
ORG43_RS13040 (2634868) 2634868..2635113 + 246 WP_000939947.1 excisionase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2576983..2638662 61679


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-94)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8640.11 Da        Isoelectric Point: 10.5308

>T264518 WP_108429764.1 NZ_CP110934:2629710-2629940 [Salmonella enterica]
MKVYGSNLGEPHTSAFGDGLFELRIKGSDGIARVFYCTLAGKRIVMLHSFIKKTQKTPVAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11110.77 Da        Isoelectric Point: 7.0152

>AT264518 WP_000147078.1 NZ_CP110934:2629930-2630238 [Salmonella enterica]
MTGKRNAPTITHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLAAGVSG
PSFTTLKKFAQATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References