Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 342235..342901 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B5Q945 |
Locus tag | OQW59_RS04530 | Protein ID | WP_003847996.1 |
Coordinates | 342584..342901 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | OQW59_RS04525 | Protein ID | WP_003837894.1 |
Coordinates | 342235..342531 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS04510 (339411) | 339411..339884 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
OQW59_RS04515 (340110) | 340110..340829 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
OQW59_RS04520 (340826) | 340826..342178 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
OQW59_RS04525 (342235) | 342235..342531 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
OQW59_RS04530 (342584) | 342584..342901 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
OQW59_RS04535 (343024) | 343024..344646 | - | 1623 | WP_213168235.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
OQW59_RS04540 (345025) | 345025..346743 | + | 1719 | WP_148374155.1 | DUF4153 domain-containing protein | - |
OQW59_RS04545 (346853) | 346853..347731 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T264467 WP_003847996.1 NZ_CP110894:c342901-342584 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5Q945 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U6IRD5 |