Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13599..14256 Replicon plasmid pCF1807-2
Accession NZ_CP110892
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OQW59_RS01710 Protein ID WP_000270043.1
Coordinates 13906..14256 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OQW59_RS01705 Protein ID WP_000124640.1
Coordinates 13599..13901 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS01655 (OQW59_01650) 9233..9661 + 429 WP_000591076.1 hypothetical protein -
OQW59_RS01660 (OQW59_01655) 9719..10078 + 360 WP_000422769.1 hypothetical protein -
OQW59_RS01665 (OQW59_01660) 10078..10524 + 447 WP_000919343.1 hypothetical protein -
OQW59_RS01670 (OQW59_01665) 10521..11039 + 519 WP_000210757.1 nitrite reductase -
OQW59_RS01675 (OQW59_01670) 11039..11269 + 231 WP_000972665.1 hypothetical protein -
OQW59_RS01680 (OQW59_01675) 11256..12113 + 858 WP_001167036.1 hypothetical protein -
OQW59_RS01685 (OQW59_01680) 12139..12330 + 192 WP_001270409.1 hypothetical protein -
OQW59_RS01690 (OQW59_01685) 12333..12860 + 528 WP_004201083.1 thermonuclease family protein -
OQW59_RS01695 (OQW59_01690) 12918..13190 + 273 WP_001043046.1 HU family DNA-binding protein -
OQW59_RS01700 (OQW59_01695) 13279..13572 + 294 WP_001239998.1 hypothetical protein -
OQW59_RS01705 (OQW59_01700) 13599..13901 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OQW59_RS01710 (OQW59_01705) 13906..14256 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OQW59_RS01715 (OQW59_01710) 14419..14967 + 549 WP_001061573.1 hypothetical protein -
OQW59_RS01720 (OQW59_01715) 15308..15502 + 195 WP_000343597.1 hypothetical protein -
OQW59_RS01725 (OQW59_01720) 15513..15884 + 372 WP_000516918.1 hypothetical protein -
OQW59_RS01730 (OQW59_01725) 15877..16347 + 471 WP_001281821.1 hypothetical protein -
OQW59_RS01735 (OQW59_01730) 16362..16697 - 336 WP_000683477.1 hypothetical protein -
OQW59_RS01740 (OQW59_01735) 16794..17282 + 489 WP_001273096.1 DUF1643 domain-containing protein -
OQW59_RS01745 (OQW59_01740) 17285..17782 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aac(3)-IId / blaTEM-1B htpB 1..211224 211224


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T264461 WP_000270043.1 NZ_CP110892:c14256-13906 [Citrobacter freundii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT264461 WP_000124640.1 NZ_CP110892:c13901-13599 [Citrobacter freundii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References