Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4809975..4810669 | Replicon | chromosome |
Accession | NZ_CP110887 | ||
Organism | Dickeya solani strain DsR207 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | - |
Locus tag | OQ522_RS20930 | Protein ID | WP_022633739.1 |
Coordinates | 4809975..4810379 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | A0A2K8VUD1 |
Locus tag | OQ522_RS20935 | Protein ID | WP_022633740.1 |
Coordinates | 4810376..4810669 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ522_RS20900 (OQ522_11655) | 4805155..4806189 | - | 1035 | WP_022633732.1 | harpin HrpZ family protein | - |
OQ522_RS20905 (OQ522_11660) | 4806350..4806760 | - | 411 | WP_022633733.1 | HrpV family type III secretion system protein | - |
OQ522_RS20910 (OQ522_11665) | 4806757..4806945 | - | 189 | WP_022633734.1 | HrpT family type III secretion system protein | - |
OQ522_RS20915 (OQ522_11670) | 4806980..4809049 | - | 2070 | WP_023637836.1 | type III secretion system outer membrane ring subunit SctC | - |
OQ522_RS20920 (OQ522_11675) | 4809042..4809476 | - | 435 | WP_022633737.1 | type III secretion system chaperone | - |
OQ522_RS20925 (OQ522_11680) | 4809463..4809690 | - | 228 | WP_022633738.1 | type III secretion protein HrpF | - |
OQ522_RS20930 (OQ522_11685) | 4809975..4810379 | - | 405 | WP_022633739.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
OQ522_RS20935 (OQ522_11690) | 4810376..4810669 | - | 294 | WP_022633740.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OQ522_RS20940 (OQ522_11695) | 4810887..4811936 | - | 1050 | WP_022633741.1 | hypothetical protein | - |
OQ522_RS20945 (OQ522_11700) | 4812476..4813636 | + | 1161 | WP_022633742.1 | alpha/beta fold hydrolase | - |
OQ522_RS20950 (OQ522_11705) | 4813647..4814960 | - | 1314 | WP_022633743.1 | lytic murein transglycosylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4809463..4819391 | 9928 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15475.86 Da Isoelectric Point: 8.4931
>T264455 WP_022633739.1 NZ_CP110887:c4810379-4809975 [Dickeya solani]
MNIRIFKSTLIRQQLSQQELDDLVADFHAYKQNGVLPDTFGRDAPYDDDRTYPLVKAEQVAHIHLADADAPFPRFLRQFK
RTSDRAHLVYCQGAMDPEACLLIIILKPEAHKMARNNNNMHKIGMMAAAFRMKY
MNIRIFKSTLIRQQLSQQELDDLVADFHAYKQNGVLPDTFGRDAPYDDDRTYPLVKAEQVAHIHLADADAPFPRFLRQFK
RTSDRAHLVYCQGAMDPEACLLIIILKPEAHKMARNNNNMHKIGMMAAAFRMKY
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|