Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4772862..4773464 | Replicon | chromosome |
| Accession | NZ_CP110873 | ||
| Organism | Enterobacter kobei strain SCLZS19 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OQE50_RS23145 | Protein ID | WP_047624626.1 |
| Coordinates | 4773153..4773464 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B2XUJ3 |
| Locus tag | OQE50_RS23140 | Protein ID | WP_032635182.1 |
| Coordinates | 4772862..4773152 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQE50_RS23125 (4770360) | 4770360..4771262 | + | 903 | WP_008501831.1 | formate dehydrogenase subunit beta | - |
| OQE50_RS23130 (4771259) | 4771259..4771894 | + | 636 | WP_008501832.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OQE50_RS23135 (4771891) | 4771891..4772820 | + | 930 | WP_047343709.1 | formate dehydrogenase accessory protein FdhE | - |
| OQE50_RS23140 (4772862) | 4772862..4773152 | - | 291 | WP_032635182.1 | NadS family protein | Antitoxin |
| OQE50_RS23145 (4773153) | 4773153..4773464 | - | 312 | WP_047624626.1 | hypothetical protein | Toxin |
| OQE50_RS23150 (4773693) | 4773693..4774613 | + | 921 | WP_047624625.1 | alpha/beta hydrolase | - |
| OQE50_RS23155 (4774622) | 4774622..4775563 | - | 942 | WP_023336483.1 | fatty acid biosynthesis protein FabY | - |
| OQE50_RS23160 (4775608) | 4775608..4776045 | - | 438 | WP_014885747.1 | D-aminoacyl-tRNA deacylase | - |
| OQE50_RS23165 (4776042) | 4776042..4776923 | - | 882 | WP_014885748.1 | virulence factor BrkB family protein | - |
| OQE50_RS23170 (4776917) | 4776917..4777516 | - | 600 | WP_045268693.1 | glucose-1-phosphatase | - |
| OQE50_RS23175 (4777636) | 4777636..4778436 | - | 801 | WP_014885750.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12215.24 Da Isoelectric Point: 10.2130
>T264423 WP_047624626.1 NZ_CP110873:c4773464-4773153 [Enterobacter kobei]
MLFIETDIFTEDVKTLLDDDEYHKLQVFLVTQPNNGDLIQNTGGLRKIRWFSGSKGKRGGVRVIYFHRTREFEIRLLLIY
RKGIKDDLSAKEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHKLQVFLVTQPNNGDLIQNTGGLRKIRWFSGSKGKRGGVRVIYFHRTREFEIRLLLIY
RKGIKDDLSAKEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|