Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1193716..1194365 | Replicon | chromosome |
| Accession | NZ_CP110873 | ||
| Organism | Enterobacter kobei strain SCLZS19 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J0PLQ3 |
| Locus tag | OQE50_RS05720 | Protein ID | WP_014882864.1 |
| Coordinates | 1194003..1194365 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2W0GCS7 |
| Locus tag | OQE50_RS05715 | Protein ID | WP_014882863.1 |
| Coordinates | 1193716..1194015 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQE50_RS05705 (1190141) | 1190141..1192114 | + | 1974 | WP_193970167.1 | PhoX family phosphatase | - |
| OQE50_RS05710 (1192217) | 1192217..1193605 | + | 1389 | WP_014882862.1 | phenylalanine transporter | - |
| OQE50_RS05715 (1193716) | 1193716..1194015 | - | 300 | WP_014882863.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OQE50_RS05720 (1194003) | 1194003..1194365 | - | 363 | WP_014882864.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OQE50_RS05725 (1194571) | 1194571..1195806 | + | 1236 | WP_193970166.1 | MFS transporter | - |
| OQE50_RS05730 (1195822) | 1195822..1196847 | + | 1026 | WP_248188303.1 | sugar phosphate isomerase/epimerase | - |
| OQE50_RS05735 (1196840) | 1196840..1197982 | + | 1143 | WP_252072273.1 | Gfo/Idh/MocA family oxidoreductase | - |
| OQE50_RS05740 (1198058) | 1198058..1199029 | + | 972 | WP_014882868.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13952.92 Da Isoelectric Point: 6.7114
>T264415 WP_014882864.1 NZ_CP110873:c1194365-1194003 [Enterobacter kobei]
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGNKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGNKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0PLQ3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W0GCS7 |