Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3525794..3526488 | Replicon | chromosome |
Accession | NZ_CP110859 | ||
Organism | Escherichia coli strain TSW4881-W1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | OQ464_RS17315 | Protein ID | WP_001263489.1 |
Coordinates | 3525794..3526192 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OQ464_RS17320 | Protein ID | WP_000554758.1 |
Coordinates | 3526195..3526488 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3521382) | 3521382..3521462 | - | 81 | NuclAT_12 | - | - |
- (3521382) | 3521382..3521462 | - | 81 | NuclAT_12 | - | - |
- (3521382) | 3521382..3521462 | - | 81 | NuclAT_12 | - | - |
- (3521382) | 3521382..3521462 | - | 81 | NuclAT_12 | - | - |
OQ464_RS17290 (3522058) | 3522058..3522516 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
OQ464_RS17295 (3522777) | 3522777..3524234 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
OQ464_RS17300 (3524291) | 3524291..3524812 | - | 522 | Protein_3380 | peptide chain release factor H | - |
OQ464_RS17305 (3524808) | 3524808..3525014 | - | 207 | Protein_3381 | RtcB family protein | - |
OQ464_RS17310 (3525332) | 3525332..3525784 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
OQ464_RS17315 (3525794) | 3525794..3526192 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OQ464_RS17320 (3526195) | 3526195..3526488 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OQ464_RS17325 (3526540) | 3526540..3527595 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
OQ464_RS17330 (3527666) | 3527666..3528451 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
OQ464_RS17335 (3528423) | 3528423..3530135 | + | 1713 | Protein_3387 | flagellar biosynthesis protein FlhA | - |
OQ464_RS17340 (3530359) | 3530359..3530856 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T264404 WP_001263489.1 NZ_CP110859:c3526192-3525794 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |