Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 36832..37562 | Replicon | chromosome |
| Accession | NZ_CP110857 | ||
| Organism | Enterobacter hormaechei strain K432 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A837FIL2 |
| Locus tag | OQO37_RS00170 | Protein ID | WP_023302825.1 |
| Coordinates | 36832..37146 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OQO37_RS00175 | Protein ID | WP_032620773.1 |
| Coordinates | 37146..37562 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQO37_RS00150 (OQO37_00150) | 32498..33583 | + | 1086 | Protein_29 | cellulase family glycosylhydrolase | - |
| OQO37_RS00155 (OQO37_00155) | 33489..34673 | - | 1185 | WP_015570118.1 | multidrug efflux MFS transporter EmrD | - |
| OQO37_RS00160 (OQO37_00160) | 34849..35682 | - | 834 | WP_032620535.1 | DMT family transporter | - |
| OQO37_RS00165 (OQO37_00165) | 35745..36191 | - | 447 | WP_003861064.1 | GNAT family N-acetyltransferase | - |
| OQO37_RS00170 (OQO37_00170) | 36832..37146 | + | 315 | WP_023302825.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OQO37_RS00175 (OQO37_00175) | 37146..37562 | + | 417 | WP_032620773.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OQO37_RS00180 (OQO37_00180) | 37709..37807 | + | 99 | WP_057979964.1 | ilvB operon leader peptide IvbL | - |
| OQO37_RS00185 (OQO37_00185) | 37914..39602 | + | 1689 | WP_023302827.1 | acetolactate synthase large subunit | - |
| OQO37_RS00190 (OQO37_00190) | 39606..39893 | + | 288 | WP_015570113.1 | acetolactate synthase small subunit | - |
| OQO37_RS00195 (OQO37_00195) | 40019..40612 | + | 594 | WP_003861054.1 | transcriptional regulator UhpA | - |
| OQO37_RS00200 (OQO37_00200) | 40609..42114 | + | 1506 | WP_032634219.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12415.51 Da Isoelectric Point: 10.2825
>T264375 WP_023302825.1 NZ_CP110857:36832-37146 [Enterobacter hormaechei]
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15249.77 Da Isoelectric Point: 5.2068
>AT264375 WP_032620773.1 NZ_CP110857:37146-37562 [Enterobacter hormaechei]
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANGPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|