Detailed information of TA system TA264353

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 121857..122283
• Replicon: plasmid pHB42-F5
• Accession: NZ_CP110817
• Organism: Escherichia coli strain THB42-F5

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N0566_RS23050
• Protein ID: WP_001372321.1
• Coordinates: 122158..122283 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	121857..122081 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0566_RS23015 (117016)	117016..117477	-	462	Protein_128	hypothetical protein	-
N0566_RS23020 (117779)	117779..118306	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N0566_RS23025 (118364)	118364..118597	+	234	WP_000006003.1	DUF905 family protein	-
N0566_RS23030 (118658)	118658..120626	+	1969	Protein_131	ParB/RepB/Spo0J family partition protein	-
N0566_RS23035 (120695)	120695..121129	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N0566_RS23040 (121126)	121126..121888	+	763	Protein_133	plasmid SOS inhibition protein A	-
- (121857)	121857..122081	+	225	NuclAT_0	-	Antitoxin
- (121857)	121857..122081	+	225	NuclAT_0	-	Antitoxin
- (121857)	121857..122081	+	225	NuclAT_0	-	Antitoxin
- (121857)	121857..122081	+	225	NuclAT_0	-	Antitoxin
N0566_RS23045 (122067)	122067..122216	+	150	Protein_134	plasmid maintenance protein Mok	-
N0566_RS23050 (122158)	122158..122283	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0566_RS23055 (122602)	122602..122898	-	297	Protein_136	hypothetical protein	-
N0566_RS23060 (123198)	123198..123494	+	297	WP_001272251.1	hypothetical protein	-
N0566_RS23065 (123605)	123605..124426	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N0566_RS23070 (124723)	124723..125370	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N0566_RS23075 (125647)	125647..126030	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0566_RS23080 (126221)	126221..126907	+	687	WP_015059009.1	PAS domain-containing protein	-
N0566_RS23085 (127001)	127001..127228	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aph(3')-IIa / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / blaCTX-M-55	-	1..161920	161920

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T264353 WP_001372321.1 NZ_CP110817:122158-122283 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT264353 NZ_CP110817:121857-122081 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin