Detailed information of TA system TA264322

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 122849..123118
• Replicon: plasmid pHB42-F4
• Accession: NZ_CP110815
• Organism: Escherichia coli strain THB42-F4

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N0552_RS23055
• Protein ID: WP_001372321.1
• Coordinates: 122993..123118 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	122849..122914 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0552_RS23020	117851..118312	-	462	Protein_132	hypothetical protein	-
N0552_RS23025	118614..119141	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N0552_RS23030	119199..119432	+	234	WP_000006003.1	DUF905 family protein	-
N0552_RS23035	119493..121461	+	1969	Protein_135	ParB/RepB/Spo0J family partition protein	-
N0552_RS23040	121530..121964	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N0552_RS23045	121961..122723	+	763	Protein_137	plasmid SOS inhibition protein A	-
-	122692..122916	+	225	NuclAT_0	-	-
-	122692..122916	+	225	NuclAT_0	-	-
-	122692..122916	+	225	NuclAT_0	-	-
-	122692..122916	+	225	NuclAT_0	-	-
-	122849..122914	-	66	-	-	Antitoxin
N0552_RS23050	122902..123051	+	150	Protein_138	plasmid maintenance protein Mok	-
N0552_RS23055	122993..123118	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0552_RS23060	123437..123733	-	297	Protein_140	hypothetical protein	-
N0552_RS23065	124033..124329	+	297	WP_001272251.1	hypothetical protein	-
N0552_RS23070	124440..125261	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N0552_RS23075	125558..126205	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N0552_RS23080	126482..126865	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0552_RS23085	127056..127742	+	687	WP_015059009.1	PAS domain-containing protein	-
N0552_RS23090	127836..128063	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55	-	1..162755	162755

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T264322 WP_001372321.1 NZ_CP110815:122993-123118 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT264322 NZ_CP110815:c122914-122849 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin