Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 183641..183863 | Replicon | chromosome |
Accession | NZ_CP110814 | ||
Organism | Escherichia coli strain THB42-F4 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | N0552_RS00880 | Protein ID | WP_000141634.1 |
Coordinates | 183756..183863 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 183641..183707 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0552_RS00860 | 179082..179984 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
N0552_RS00865 | 179995..180978 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
N0552_RS00870 | 180975..181979 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
N0552_RS00875 | 182009..183280 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
- | 183641..183707 | - | 67 | - | - | Antitoxin |
N0552_RS00880 | 183756..183863 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
N0552_RS00885 | 183950..185629 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
N0552_RS00890 | 185626..185817 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
N0552_RS00895 | 185814..187385 | - | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
N0552_RS00900 | 187658..187846 | + | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
N0552_RS00905 | 187882..188610 | + | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T264292 WP_000141634.1 NZ_CP110814:183756-183863 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT264292 NZ_CP110814:c183707-183641 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|