Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1696946..1697460 | Replicon | chromosome |
Accession | NZ_CP110798 | ||
Organism | Limosilactobacillus fermentum strain BRD_L14 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | OP867_RS08695 | Protein ID | WP_265707939.1 |
Coordinates | 1696946..1697209 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C0WV67 |
Locus tag | OP867_RS08700 | Protein ID | WP_003684069.1 |
Coordinates | 1697206..1697460 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP867_RS08670 (OP867_08670) | 1692795..1693235 | - | 441 | WP_075667502.1 | KxYKxGKxW signal peptide domain-containing protein | - |
OP867_RS08675 (OP867_08675) | 1693427..1693843 | - | 417 | Protein_1663 | IS256 family transposase | - |
OP867_RS08680 (OP867_08680) | 1693999..1694679 | - | 681 | WP_265707938.1 | IS30 family transposase | - |
OP867_RS08685 (OP867_08685) | 1694783..1694908 | + | 126 | Protein_1665 | zinc ribbon domain-containing protein | - |
OP867_RS08690 (OP867_08690) | 1695415..1696536 | + | 1122 | WP_023465987.1 | PTS sugar transporter subunit IIC | - |
OP867_RS08695 (OP867_08695) | 1696946..1697209 | - | 264 | WP_265707939.1 | Txe/YoeB family addiction module toxin | Toxin |
OP867_RS08700 (OP867_08700) | 1697206..1697460 | - | 255 | WP_003684069.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OP867_RS08705 (OP867_08705) | 1697622..1698287 | - | 666 | Protein_1669 | family 1 glycosylhydrolase | - |
OP867_RS08710 (OP867_08710) | 1698538..1699197 | - | 660 | WP_004562986.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
OP867_RS08715 (OP867_08715) | 1699748..1700068 | - | 321 | WP_262335471.1 | hypothetical protein | - |
OP867_RS08720 (OP867_08720) | 1700073..1700429 | - | 357 | WP_004562984.1 | MmcQ/YjbR family DNA-binding protein | - |
OP867_RS08725 (OP867_08725) | 1700431..1701078 | - | 648 | WP_265707940.1 | sel1 repeat family protein | - |
OP867_RS08730 (OP867_08730) | 1701207..1702175 | - | 969 | WP_023465990.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1686144..1705340 | 19196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10293.99 Da Isoelectric Point: 10.0702
>T264266 WP_265707939.1 NZ_CP110798:c1697209-1696946 [Limosilactobacillus fermentum]
MSYAIELKRSANKELKKIKGLYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
MSYAIELKRSANKELKKIKGLYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|