Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 1530168..1530839 | Replicon | chromosome |
| Accession | NZ_CP110790 | ||
| Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0T9T807 |
| Locus tag | OP862_RS06780 | Protein ID | WP_050080100.1 |
| Coordinates | 1530168..1530500 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OP862_RS06785 | Protein ID | WP_050080099.1 |
| Coordinates | 1530519..1530839 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP862_RS06760 (OP862_06760) | 1525770..1527428 | + | 1659 | WP_167311404.1 | thiamine pyrophosphate-binding protein | - |
| OP862_RS06765 (OP862_06765) | 1527403..1528287 | - | 885 | WP_050080103.1 | LysR family transcriptional regulator | - |
| OP862_RS06770 (OP862_06770) | 1528389..1528871 | + | 483 | WP_050080102.1 | multidrug/biocide efflux PACE transporter | - |
| OP862_RS06775 (OP862_06775) | 1529040..1530011 | + | 972 | WP_050080101.1 | glucokinase | - |
| OP862_RS06780 (OP862_06780) | 1530168..1530500 | + | 333 | WP_050080100.1 | toxin | Toxin |
| OP862_RS06785 (OP862_06785) | 1530519..1530839 | + | 321 | WP_050080099.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| OP862_RS06790 (OP862_06790) | 1530865..1532109 | - | 1245 | WP_057649765.1 | OFA family MFS transporter | - |
| OP862_RS06795 (OP862_06795) | 1532323..1533063 | - | 741 | WP_050080097.1 | LytTR family DNA-binding domain-containing protein | - |
| OP862_RS06800 (OP862_06800) | 1533067..1534767 | - | 1701 | WP_167311403.1 | sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12914.87 Da Isoelectric Point: 10.1237
>T264244 WP_050080100.1 NZ_CP110790:1530168-1530500 [Yersinia massiliensis]
MDAVFIELPPFERVRLDYLSDDDYRTLQTALMNNPTVGDVIQQTGGLRKMRFSEAKTGKGKRSGVRVIYYWWVERFQFLL
FTIYSKGEMSDLTHSQRKILSNLLKSRKSE
MDAVFIELPPFERVRLDYLSDDDYRTLQTALMNNPTVGDVIQQTGGLRKMRFSEAKTGKGKRSGVRVIYYWWVERFQFLL
FTIYSKGEMSDLTHSQRKILSNLLKSRKSE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|