Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 1292345..1293014 | Replicon | chromosome |
| Accession | NZ_CP110789 | ||
| Organism | Yersinia intermedia strain SCPM-O-B-10209 (333) | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OP861_RS05815 | Protein ID | WP_050084850.1 |
| Coordinates | 1292345..1292692 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OP861_RS05820 | Protein ID | WP_050084851.1 |
| Coordinates | 1292697..1293014 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP861_RS05790 (OP861_05790) | 1287919..1288335 | - | 417 | WP_074000306.1 | DUF2502 domain-containing protein | - |
| OP861_RS05795 (OP861_05795) | 1288493..1289482 | - | 990 | WP_265535709.1 | aldo/keto reductase | - |
| OP861_RS05800 (OP861_05800) | 1289609..1290493 | - | 885 | WP_050084847.1 | LysR family transcriptional regulator | - |
| OP861_RS05805 (OP861_05805) | 1290596..1291072 | + | 477 | WP_050133193.1 | multidrug/biocide efflux PACE transporter | - |
| OP861_RS05810 (OP861_05810) | 1291249..1292214 | + | 966 | WP_265535710.1 | glucokinase | - |
| OP861_RS05815 (OP861_05815) | 1292345..1292692 | + | 348 | WP_050084850.1 | toxin | Toxin |
| OP861_RS05820 (OP861_05820) | 1292697..1293014 | + | 318 | WP_050084851.1 | transcriptional regulator | Antitoxin |
| OP861_RS05825 (OP861_05825) | 1293040..1294284 | - | 1245 | WP_241916199.1 | OFA family MFS transporter | - |
| OP861_RS05830 (OP861_05830) | 1294508..1295248 | - | 741 | WP_050133197.1 | LytTR family DNA-binding domain-containing protein | - |
| OP861_RS05835 (OP861_05835) | 1295252..1296952 | - | 1701 | WP_005183692.1 | sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13688.04 Da Isoelectric Point: 9.9631
>T264233 WP_050084850.1 NZ_CP110789:1292345-1292692 [Yersinia intermedia]
MDAVFVELPSFERLRFEYLSDDEYRSLQIMLMNNPMIGDVIQQTGGLRKMRFSDPRRGKGKRGGVRVIYYWWVERLQFLL
FTLYSKGEMTDLTETQRKILGDLLKCRKAELTLLR
MDAVFVELPSFERLRFEYLSDDEYRSLQIMLMNNPMIGDVIQQTGGLRKMRFSDPRRGKGKRGGVRVIYYWWVERLQFLL
FTLYSKGEMTDLTETQRKILGDLLKCRKAELTLLR
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|