Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 996426..996588 | Replicon | chromosome |
| Accession | NZ_CP110784 | ||
| Organism | Staphylococcus capitis strain CCSM0123 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | OP858_RS04940 | Protein ID | WP_016898319.1 |
| Coordinates | 996426..996530 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 996558..996588 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP858_RS04930 (OP858_04930) | 992358..995297 | + | 2940 | WP_016898320.1 | AAA family ATPase | - |
| OP858_RS04935 (OP858_04935) | 995294..996235 | + | 942 | WP_002434737.1 | 3'-5' exoribonuclease YhaM | - |
| OP858_RS04940 (OP858_04940) | 996426..996530 | + | 105 | WP_016898319.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 996558..996588 | + | 31 | - | - | Antitoxin |
| OP858_RS04945 (OP858_04945) | 996685..997686 | - | 1002 | WP_002453569.1 | peptidylprolyl isomerase | - |
| OP858_RS04950 (OP858_04950) | 997885..998454 | - | 570 | WP_002453568.1 | DUF3267 domain-containing protein | - |
| OP858_RS04955 (OP858_04955) | 998646..999017 | - | 372 | WP_002434824.1 | YtxH domain-containing protein | - |
| OP858_RS04960 (OP858_04960) | 999095..999520 | - | 426 | WP_002434751.1 | HIT family protein | - |
| OP858_RS04965 (OP858_04965) | 999653..1000393 | + | 741 | WP_267263570.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3993.76 Da Isoelectric Point: 10.7588
>T264223 WP_016898319.1 NZ_CP110784:996426-996530 [Staphylococcus capitis]
MLFDIFVHIMTTATSGCIVALFAHWLRTRNDKRK
MLFDIFVHIMTTATSGCIVALFAHWLRTRNDKRK
Download Length: 105 bp
Antitoxin
Download Length: 31 bp
>AT264223 NZ_CP110784:996558-996588 [Staphylococcus capitis]
AAATCCCCTCACTACTGCCATAGTGAGGGGA
AAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|