Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3236089..3236737 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0D7M266 |
Locus tag | OPR78_RS16140 | Protein ID | WP_016151211.1 |
Coordinates | 3236375..3236737 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0D7LEH2 |
Locus tag | OPR78_RS16135 | Protein ID | WP_003840660.1 |
Coordinates | 3236089..3236388 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS16115 (3232411) | 3232411..3232827 | - | 417 | WP_003023951.1 | GNAT family N-acetyltransferase | - |
OPR78_RS16120 (3232958) | 3232958..3233251 | + | 294 | WP_003840665.1 | YicS family protein | - |
OPR78_RS16125 (3233346) | 3233346..3234728 | + | 1383 | WP_016151210.1 | glycoside hydrolase family 1 protein | - |
OPR78_RS16130 (3234777) | 3234777..3235970 | - | 1194 | WP_003840662.1 | purine ribonucleoside efflux pump NepI | - |
OPR78_RS16135 (3236089) | 3236089..3236388 | - | 300 | WP_003840660.1 | XRE family transcriptional regulator | Antitoxin |
OPR78_RS16140 (3236375) | 3236375..3236737 | - | 363 | WP_016151211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OPR78_RS16145 (3236838) | 3236838..3237290 | - | 453 | WP_003023933.1 | DUF1198 family protein | - |
OPR78_RS16150 (3237416) | 3237416..3238807 | - | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
OPR78_RS16155 (3238950) | 3238950..3240278 | - | 1329 | WP_003023927.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13788.66 Da Isoelectric Point: 5.1976
>T264208 WP_016151211.1 NZ_CP110775:c3236737-3236375 [Citrobacter freundii]
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7M266 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LEH2 |