Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2903556..2904222 | Replicon | chromosome |
| Accession | NZ_CP110775 | ||
| Organism | Citrobacter freundii strain Cf-Emp | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B5Q945 |
| Locus tag | OPR78_RS14585 | Protein ID | WP_003847996.1 |
| Coordinates | 2903556..2903873 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4U6IRD5 |
| Locus tag | OPR78_RS14590 | Protein ID | WP_003837894.1 |
| Coordinates | 2903926..2904222 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPR78_RS14570 (2898726) | 2898726..2899604 | + | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
| OPR78_RS14575 (2899714) | 2899714..2901432 | - | 1719 | WP_047715944.1 | DUF4153 domain-containing protein | - |
| OPR78_RS14580 (2901811) | 2901811..2903433 | + | 1623 | WP_044701411.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
| OPR78_RS14585 (2903556) | 2903556..2903873 | + | 318 | WP_003847996.1 | hypothetical protein | Toxin |
| OPR78_RS14590 (2903926) | 2903926..2904222 | + | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
| OPR78_RS14595 (2904279) | 2904279..2905631 | - | 1353 | WP_275269332.1 | two-component system sensor histidine kinase EnvZ | - |
| OPR78_RS14600 (2905628) | 2905628..2906347 | - | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
| OPR78_RS14605 (2906573) | 2906573..2907046 | + | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T264206 WP_003847996.1 NZ_CP110775:2903556-2903873 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5Q945 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U6IRD5 |