Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-YefM
Location 2806439..2806971 Replicon chromosome
Accession NZ_CP110679
Organism Sphingomonas sp. S6-11

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag OKW87_RS13475 Protein ID WP_265540266.1
Coordinates 2806705..2806971 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag OKW87_RS13470 Protein ID WP_265540265.1
Coordinates 2806439..2806708 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKW87_RS13425 (OKW87_13425) 2801863..2802186 + 324 WP_265540256.1 hypothetical protein -
OKW87_RS13430 (OKW87_13430) 2802224..2802718 - 495 WP_265540257.1 DNA starvation/stationary phase protection protein -
OKW87_RS13435 (OKW87_13435) 2802803..2803366 - 564 WP_265540258.1 TMEM165/GDT1 family protein -
OKW87_RS13440 (OKW87_13440) 2803529..2803696 + 168 WP_265540259.1 50S ribosomal protein L33 -
OKW87_RS13445 (OKW87_13445) 2803829..2804116 + 288 WP_265540260.1 hypothetical protein -
OKW87_RS13450 (OKW87_13450) 2804270..2804395 + 126 WP_265540261.1 hypothetical protein -
OKW87_RS13455 (OKW87_13455) 2804404..2804712 + 309 WP_265540262.1 zinc ribbon domain-containing protein YjdM -
OKW87_RS13460 (OKW87_13460) 2804765..2805658 - 894 WP_265540263.1 hypothetical protein -
OKW87_RS13465 (OKW87_13465) 2805767..2806399 - 633 WP_265540264.1 VOC family protein -
OKW87_RS13470 (OKW87_13470) 2806439..2806708 + 270 WP_265540265.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OKW87_RS13475 (OKW87_13475) 2806705..2806971 + 267 WP_265540266.1 Txe/YoeB family addiction module toxin Toxin
OKW87_RS13480 (OKW87_13480) 2807177..2807692 - 516 WP_265540267.1 hypothetical protein -
OKW87_RS13485 (OKW87_13485) 2807867..2808343 - 477 WP_265540268.1 DUF1579 domain-containing protein -
OKW87_RS13490 (OKW87_13490) 2808482..2808856 - 375 WP_265540269.1 ferredoxin -
OKW87_RS13495 (OKW87_13495) 2808874..2810769 - 1896 WP_265540270.1 phosphomethylpyrimidine synthase ThiC -
OKW87_RS13500 (OKW87_13500) 2810943..2811326 - 384 WP_265540271.1 DUF2141 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(7-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(7-78)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10532.05 Da        Isoelectric Point: 8.7236

>T264192 WP_265540266.1 NZ_CP110679:2806705-2806971 [Sphingomonas sp. S6-11]
VKIVFWPTALEDYLHWQAEDTRLLERVNALLKECRRDPFRGLGKPEPLGKNMSCWWSRRIDREHRLVYRVTGSGEAQTVE
VAQCRYHY

Download         Length: 267 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9815.18 Da        Isoelectric Point: 4.3813

>AT264192 WP_265540265.1 NZ_CP110679:2806439-2806708 [Sphingomonas sp. S6-11]
MYIEYIEILSTSEARANIKAVMDRVVANRAPIGISRPKGEGVVMVSQSEWDSIEETMYLLASPKNAERLLEAIRGLQAGG
GEEHELIDP

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References