Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2038005..2038924 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | L7N4R2 |
| Locus tag | OO115_RS09395 | Protein ID | WP_003900449.1 |
| Coordinates | 2038319..2038924 (-) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | OO115_RS09390 | Protein ID | WP_003410124.1 |
| Coordinates | 2038005..2038310 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS09355 (OO115_09355) | 2033268..2033468 | + | 201 | Protein_1855 | hypothetical protein | - |
| OO115_RS09365 (OO115_09365) | 2034824..2035201 | + | 378 | Protein_1857 | hypothetical protein | - |
| OO115_RS09370 (OO115_09370) | 2035198..2036238 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OO115_RS09375 (OO115_09375) | 2036480..2037199 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| OO115_RS09380 (OO115_09380) | 2037189..2037605 | + | 417 | WP_003410114.1 | hypothetical protein | - |
| OO115_RS09385 (OO115_09385) | 2037621..2037920 | - | 300 | WP_003410120.1 | hypothetical protein | - |
| OO115_RS09390 (OO115_09390) | 2038005..2038310 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| OO115_RS09395 (OO115_09395) | 2038319..2038924 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OO115_RS09400 (OO115_09400) | 2038949..2039308 | - | 360 | WP_003410131.1 | hypothetical protein | - |
| OO115_RS09405 (OO115_09405) | 2039468..2040058 | - | 591 | WP_223695536.1 | hypothetical protein | - |
| OO115_RS09410 (OO115_09410) | 2040097..2040333 | - | 237 | WP_003410133.1 | hypothetical protein | - |
| OO115_RS09415 (OO115_09415) | 2040540..2041436 | - | 897 | WP_003410136.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T264156 WP_003900449.1 NZ_CP110674:c2038924-2038319 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BV20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |