Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3878670..3879256 Replicon chromosome
Accession NZ_CP110661
Organism Klebsiella pneumoniae strain B431

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OOS97_RS19070 Protein ID WP_023285605.1
Coordinates 3878670..3879038 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OOS97_RS19075 Protein ID WP_004174006.1
Coordinates 3879035..3879256 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOS97_RS19050 (3874173) 3874173..3875243 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OOS97_RS19055 (3875245) 3875245..3876090 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OOS97_RS19060 (3876087) 3876087..3876974 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OOS97_RS19065 (3877081) 3877081..3878397 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OOS97_RS19070 (3878670) 3878670..3879038 - 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OOS97_RS19075 (3879035) 3879035..3879256 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OOS97_RS19080 (3879420) 3879420..3880133 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OOS97_RS19085 (3880135) 3880135..3880902 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OOS97_RS19090 (3880899) 3880899..3882176 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OOS97_RS19095 (3882173) 3882173..3883099 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3873436..3894150 20714


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T264109 WP_023285605.1 NZ_CP110661:c3879038-3878670 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT264109 WP_004174006.1 NZ_CP110661:c3879256-3879035 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References