Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2279992..2280594 | Replicon | chromosome |
| Accession | NZ_CP110657 | ||
| Organism | Salmonella enterica subsp. enterica strain S2122 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | OOK64_RS11305 | Protein ID | WP_001159630.1 |
| Coordinates | 2279992..2280303 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OOK64_RS11310 | Protein ID | WP_000362050.1 |
| Coordinates | 2280304..2280594 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK64_RS11270 (2275105) | 2275105..2275704 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OOK64_RS11275 (2275698) | 2275698..2276570 | + | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| OOK64_RS11280 (2276567) | 2276567..2277004 | + | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| OOK64_RS11285 (2277049) | 2277049..2277990 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OOK64_RS11290 (2278005) | 2278005..2278451 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| OOK64_RS11295 (2278448) | 2278448..2278759 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| OOK64_RS11300 (2278845) | 2278845..2279774 | - | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| OOK64_RS11305 (2279992) | 2279992..2280303 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| OOK64_RS11310 (2280304) | 2280304..2280594 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| OOK64_RS11315 (2280641) | 2280641..2281570 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OOK64_RS11320 (2281567) | 2281567..2282202 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OOK64_RS11325 (2282199) | 2282199..2283101 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T264092 WP_001159630.1 NZ_CP110657:2279992-2280303 [Salmonella enterica subsp. enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|