Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 1718234..1718772 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | OOK64_RS08680 | Protein ID | WP_001526148.1 |
Coordinates | 1718234..1718509 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | M7RMV7 |
Locus tag | OOK64_RS08685 | Protein ID | WP_000729713.1 |
Coordinates | 1718512..1718772 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS08675 (1715441) | 1715441..1718146 | + | 2706 | WP_000907029.1 | HTH-type transcriptional regulator MalT | - |
OOK64_RS08680 (1718234) | 1718234..1718509 | - | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OOK64_RS08685 (1718512) | 1718512..1718772 | - | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OOK64_RS08690 (1718881) | 1718881..1719900 | - | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
OOK64_RS08695 (1719904) | 1719904..1721118 | - | 1215 | WP_001105521.1 | RNA-splicing ligase RtcB | - |
OOK64_RS08700 (1721466) | 1721466..1721657 | - | 192 | Protein_1698 | TROVE domain-containing protein | - |
OOK64_RS08705 (1721666) | 1721666..1723219 | - | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T264088 WP_001526148.1 NZ_CP110657:c1718509-1718234 [Salmonella enterica subsp. enterica]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D6P2L2 |