Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 25111..25336 Replicon chromosome
Accession NZ_CP110657
Organism Salmonella enterica subsp. enterica strain S2122

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag OOK64_RS00195 Protein ID WP_000813254.1
Coordinates 25111..25266 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 25278..25336 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOK64_RS00145 20438..20986 + 549 WP_000762846.1 hypothetical protein -
OOK64_RS00150 21119..21304 - 186 WP_000113285.1 hypothetical protein -
OOK64_RS00155 21285..21563 - 279 WP_173671027.1 hypothetical protein -
OOK64_RS00160 21448..21840 - 393 WP_042043867.1 DUF2570 domain-containing protein -
OOK64_RS00165 21824..22300 - 477 WP_001194114.1 glycoside hydrolase family protein -
OOK64_RS00170 22304..22639 - 336 WP_001533367.1 phage holin, lambda family -
OOK64_RS00175 23123..23665 - 543 WP_000640144.1 DUF1133 family protein -
OOK64_RS00180 23662..23952 - 291 WP_001533370.1 DUF1364 domain-containing protein -
OOK64_RS00185 23952..24551 - 600 WP_052929183.1 DUF1367 family protein -
OOK64_RS00190 24623..24835 - 213 WP_052929182.1 hypothetical protein -
OOK64_RS00195 25111..25266 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 25278..25336 + 59 - - Antitoxin
OOK64_RS00200 25824..26921 + 1098 WP_042973270.1 beta family protein -
OOK64_RS00205 26881..27459 - 579 WP_001204666.1 sce7726 family protein -
OOK64_RS00210 27733..27933 - 201 WP_042973267.1 hypothetical protein -
OOK64_RS00215 27930..28352 - 423 WP_050306692.1 DUF977 family protein -
OOK64_RS00220 28368..29129 - 762 WP_139707682.1 DUF1627 domain-containing protein -
OOK64_RS00225 29152..29898 - 747 WP_052929112.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 337..45397 45060


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T264079 WP_000813254.1 NZ_CP110657:c25266-25111 [Salmonella enterica subsp. enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT264079 NZ_CP110657:25278-25336 [Salmonella enterica subsp. enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References