Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 1980355..1980684 | Replicon | chromosome |
| Accession | NZ_CP110634 | ||
| Organism | Bacillus subtilis strain MG-1 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | OOZ27_RS10280 | Protein ID | WP_080010576.1 |
| Coordinates | 1980433..1980684 (+) | Length | 84 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 1980355..1980455 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ27_RS10255 | 1975520..1975798 | - | 279 | WP_144460160.1 | HU family DNA-binding protein | - |
| OOZ27_RS10260 | 1976061..1976693 | - | 633 | Protein_1967 | hypothetical protein | - |
| OOZ27_RS10265 | 1977094..1978968 | - | 1875 | Protein_1968 | DNA-directed RNA polymerase YonO | - |
| OOZ27_RS10270 | 1979008..1979202 | - | 195 | WP_017696862.1 | hypothetical protein | - |
| - | 1980197..1980297 | - | 101 | NuclAT_0 | - | - |
| - | 1980197..1980297 | - | 101 | NuclAT_0 | - | - |
| - | 1980197..1980297 | - | 101 | NuclAT_0 | - | - |
| - | 1980197..1980297 | - | 101 | NuclAT_0 | - | - |
| OOZ27_RS10275 | 1980238..1980414 | + | 177 | WP_017696861.1 | hypothetical protein | - |
| - | 1980355..1980455 | - | 101 | - | - | Antitoxin |
| OOZ27_RS10280 | 1980433..1980684 | + | 252 | WP_080010576.1 | hypothetical protein | Toxin |
| OOZ27_RS10285 | 1980729..1980890 | + | 162 | WP_106293942.1 | hypothetical protein | - |
| OOZ27_RS10290 | 1981001..1982218 | + | 1218 | WP_144460167.1 | hypothetical protein | - |
| OOZ27_RS10295 | 1982561..1983709 | + | 1149 | WP_144460169.1 | DUF342 domain-containing protein | - |
| OOZ27_RS10300 | 1983722..1984213 | + | 492 | WP_144460171.1 | helix-turn-helix transcriptional regulator | - |
| OOZ27_RS10305 | 1984228..1984665 | + | 438 | WP_165882326.1 | helix-turn-helix domain-containing protein | - |
| OOZ27_RS10310 | 1984701..1984982 | + | 282 | WP_041338606.1 | hypothetical protein | - |
| OOZ27_RS10315 | 1985044..1985268 | + | 225 | WP_029727199.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1916474..2069210 | 152736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10071.13 Da Isoelectric Point: 10.0301
>T264046 WP_080010576.1 NZ_CP110634:1980433-1980684 [Bacillus subtilis]
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
Download Length: 252 bp
Antitoxin
Download Length: 101 bp
>AT264046 NZ_CP110634:c1980455-1980355 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|