Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrH/- |
Location | 1980197..1980414 | Replicon | chromosome |
Accession | NZ_CP110634 | ||
Organism | Bacillus subtilis strain MG-1 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | OOZ27_RS10275 | Protein ID | WP_017696861.1 |
Coordinates | 1980238..1980414 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 1980197..1980297 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOZ27_RS10255 (1975520) | 1975520..1975798 | - | 279 | WP_144460160.1 | HU family DNA-binding protein | - |
OOZ27_RS10260 (1976061) | 1976061..1976693 | - | 633 | Protein_1967 | hypothetical protein | - |
OOZ27_RS10265 (1977094) | 1977094..1978968 | - | 1875 | Protein_1968 | DNA-directed RNA polymerase YonO | - |
OOZ27_RS10270 (1979008) | 1979008..1979202 | - | 195 | WP_017696862.1 | hypothetical protein | - |
- (1980197) | 1980197..1980297 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1980197) | 1980197..1980297 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1980197) | 1980197..1980297 | - | 101 | NuclAT_0 | - | Antitoxin |
- (1980197) | 1980197..1980297 | - | 101 | NuclAT_0 | - | Antitoxin |
OOZ27_RS10275 (1980238) | 1980238..1980414 | + | 177 | WP_017696861.1 | hypothetical protein | Toxin |
OOZ27_RS10280 (1980433) | 1980433..1980684 | + | 252 | WP_080010576.1 | hypothetical protein | - |
OOZ27_RS10285 (1980729) | 1980729..1980890 | + | 162 | WP_106293942.1 | hypothetical protein | - |
OOZ27_RS10290 (1981001) | 1981001..1982218 | + | 1218 | WP_144460167.1 | hypothetical protein | - |
OOZ27_RS10295 (1982561) | 1982561..1983709 | + | 1149 | WP_144460169.1 | DUF342 domain-containing protein | - |
OOZ27_RS10300 (1983722) | 1983722..1984213 | + | 492 | WP_144460171.1 | helix-turn-helix transcriptional regulator | - |
OOZ27_RS10305 (1984228) | 1984228..1984665 | + | 438 | WP_165882326.1 | helix-turn-helix domain-containing protein | - |
OOZ27_RS10310 (1984701) | 1984701..1984982 | + | 282 | WP_041338606.1 | hypothetical protein | - |
OOZ27_RS10315 (1985044) | 1985044..1985268 | + | 225 | WP_029727199.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1916474..2069210 | 152736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T264039 WP_017696861.1 NZ_CP110634:1980238-1980414 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT264039 NZ_CP110634:c1980297-1980197 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|