Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3554177..3554847 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | M7V54_RS16885 | Protein ID | WP_003899954.1 |
Coordinates | 3554177..3554521 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | M7V54_RS16890 | Protein ID | WP_003899955.1 |
Coordinates | 3554518..3554847 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS16850 | 3549250..3550110 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
M7V54_RS16855 | 3550085..3550600 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
M7V54_RS16860 | 3550616..3550827 | + | 212 | Protein_3329 | (R)-hydratase | - |
M7V54_RS16865 | 3550840..3551133 | + | 294 | WP_003416635.1 | hypothetical protein | - |
M7V54_RS16870 | 3551421..3552710 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
M7V54_RS16875 | 3553057..3553491 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
M7V54_RS16880 | 3553494..3553946 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M7V54_RS16885 | 3554177..3554521 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M7V54_RS16890 | 3554518..3554847 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
M7V54_RS16895 | 3555084..3556345 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
M7V54_RS16900 | 3556567..3557828 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
M7V54_RS16905 | 3558101..3558448 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
M7V54_RS16910 | 3558445..3559065 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T264022 WP_003899954.1 NZ_CP110619:3554177-3554521 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0THF6 |