Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2268378..2269297 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | M7V54_RS10690 | Protein ID | WP_003900449.1 |
Coordinates | 2268692..2269297 (-) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | M7V54_RS10685 | Protein ID | WP_003410124.1 |
Coordinates | 2268378..2268683 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS10655 | 2263389..2264645 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
M7V54_RS10660 | 2264999..2265574 | + | 576 | WP_003410100.1 | hypothetical protein | - |
M7V54_RS10665 | 2265571..2266611 | + | 1041 | WP_003911735.1 | ImmA/IrrE family metallo-endopeptidase | - |
M7V54_RS10670 | 2266853..2267572 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
M7V54_RS10675 | 2267562..2267978 | + | 417 | WP_003410114.1 | hypothetical protein | - |
M7V54_RS10680 | 2267994..2268293 | - | 300 | WP_003410120.1 | hypothetical protein | - |
M7V54_RS10685 | 2268378..2268683 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
M7V54_RS10690 | 2268692..2269297 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M7V54_RS10695 | 2269322..2269681 | - | 360 | WP_003410131.1 | hypothetical protein | - |
M7V54_RS10700 | 2269841..2270236 | - | 396 | WP_079156352.1 | hypothetical protein | - |
M7V54_RS10705 | 2270296..2271813 | - | 1518 | Protein_2116 | DEAD/DEAH box helicase family protein | - |
M7V54_RS10710 | 2272323..2273321 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T264004 WP_003900449.1 NZ_CP110619:c2269297-2268692 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV30 |